PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010301-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 329aa    MW: 36125.8 Da    PI: 8.0856
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010301-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-135498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    NNU_010301-RA 54 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 98
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1648104IPR009057Homeodomain-like
PROSITE profilePS5129415.40849103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-652104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1852101IPR006447Myb domain, plants
SMARTSM007175.3E-1153101IPR001005SANT/Myb domain
PfamPF002492.7E-115498IPR001005SANT/Myb domain
CDDcd001672.02E-85699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVSVNPIPNP AEVFYLDPME MALPGLGSLA GATTASPDDP TKKIRKPYTI TKSRESWTEQ  60
EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KVQKNGTSEH VPPPRPKRKA  120
AHPYPQKASK NAPVLSQVTG AFQSSSSLLE PGYTLRPDSS SVFGNPIRGV AMSSWANNSV  180
PPINMTHMAK DEMISAVPAV ANNCCSSTES TPKRWPCGEV TDQGNQGPPL RGAVMPDFSQ  240
VYSFIGSVFD PNTSGHLQKL KEMDPIDVET VLLLMRNLSV NLSSPDFEDH RRLLSSYDVE  300
SDKAKSGSTN NTLPGDEPEN TSPLRTKGK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261344.10.0PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-118RVE6_ARATH; Protein REVEILLE 6
TrEMBLD7UCD41e-164D7UCD4_VITVI; Putative uncharacterized protein
STRINGVIT_15s0046g02260.t011e-164(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-105MYB_related family protein